Synaptojanin 2 antibody (70R-4941)

Rabbit polyclonal Synaptojanin 2 antibody raised against the N terminal of SYNJ2

Synonyms Polyclonal Synaptojanin 2 antibody, Anti-Synaptojanin 2 antibody, SYNJ2 antibody, INPP5H antibody, Synaptojanin 2 antibody, Synaptojanin 2, MGC44422 antibody, Synaptojanin -2, Synaptojanin -2 antibody, KIAA0348 antibody, Synaptojanin 2
Specificity Synaptojanin 2 antibody was raised against the N terminal of SYNJ2
Cross Reactivity Human
Applications WB
Immunogen Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
Assay Information Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody


Western Blot analysis using Synaptojanin 2 antibody (70R-4941)

Synaptojanin 2 antibody (70R-4941) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 165 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYNJ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Synaptojanin 2 antibody (70R-4941) | Synaptojanin 2 antibody (70R-4941) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors