Synaptojanin 2 Blocking Peptide (33R-8466)

A synthetic peptide for use as a blocking control in assays to test for specificity of SYNJ2 antibody, catalog no. 70R-4941

Synonyms Synaptojanin 2 control peptide, Synaptojanin 2 antibody Blocking Peptide, Anti-Synaptojanin 2 Blocking Peptide, INPP5H Blocking Peptide, KIAA0348 Blocking Peptide, MGC44422 Blocking Peptide, SYNJ2 Blocking Peptide, Synaptojanin 2, Synaptojanin -2, Synaptojanin 2, Synaptojanin -2 Blocking Peptide, Synaptojanin 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
Molecular Weight 165 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors