Synaptojanin 2 Blocking Peptide (33R-8466)
A synthetic peptide for use as a blocking control in assays to test for specificity of SYNJ2 antibody, catalog no. 70R-4941
Overview
Overview
| Synonyms | Synaptojanin 2 control peptide, Synaptojanin 2 antibody Blocking Peptide, Anti-Synaptojanin 2 Blocking Peptide, INPP5H Blocking Peptide, KIAA0348 Blocking Peptide, MGC44422 Blocking Peptide, SYNJ2 Blocking Peptide, Synaptojanin 2, Synaptojanin -2, Synaptojanin 2, Synaptojanin -2 Blocking Peptide, Synaptojanin 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
|---|---|
| Molecular Weight | 165 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product