TADA1L Blocking Peptide (33R-7893)

A synthetic peptide for use as a blocking control in assays to test for specificity of TADA1L antibody, catalog no. 70R-3587

Synonyms TADA1L control peptide, TADA1L antibody Blocking Peptide, Anti-TADA1L Blocking Peptide, Transcriptional Adaptor 1 Blocking Peptide, Hfi1 Homolog Yeast-Like Blocking Peptide, KIAA0764 Blocking Peptide, RP1-9E21.4 Blocking Peptide, STAF42 Blocking Peptide, TADA1L, TADAL-1, TADAL 1, TADAL-1 Blocking Peptide, TADAL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors