TADA1L Blocking Peptide (33R-7893)
A synthetic peptide for use as a blocking control in assays to test for specificity of TADA1L antibody, catalog no. 70R-3587
Overview
Overview
| Synonyms | TADA1L control peptide, TADA1L antibody Blocking Peptide, Anti-TADA1L Blocking Peptide, Transcriptional Adaptor 1 Blocking Peptide, Hfi1 Homolog Yeast-Like Blocking Peptide, KIAA0764 Blocking Peptide, RP1-9E21.4 Blocking Peptide, STAF42 Blocking Peptide, TADA1L, TADAL-1, TADAL 1, TADAL-1 Blocking Peptide, TADAL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product