TAF3 Blocking Peptide (33R-7857)

A synthetic peptide for use as a blocking control in assays to test for specificity of TAF3 antibody, catalog no. 70R-9077

Synonyms TAF3 control peptide, TAF3 antibody Blocking Peptide, Anti-TAF3 Blocking Peptide, TAF3 RNA polymerase II, TATA box binding protein, TBP-associated factor, 140kDa Blocking Peptide, MGC25063 Blocking Peptide, TAF140 Blocking Peptide, TAFII140 Blocking Peptide, TAF3, TAF-3, TAF 3, TAF-3 Blocking Peptide, TAF 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK
Molecular Weight 103 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 is required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors