TAF3 Blocking Peptide (33R-7857)
A synthetic peptide for use as a blocking control in assays to test for specificity of TAF3 antibody, catalog no. 70R-9077
Overview
Overview
| Synonyms | TAF3 control peptide, TAF3 antibody Blocking Peptide, Anti-TAF3 Blocking Peptide, TAF3 RNA polymerase II, TATA box binding protein, TBP-associated factor, 140kDa Blocking Peptide, MGC25063 Blocking Peptide, TAF140 Blocking Peptide, TAFII140 Blocking Peptide, TAF3, TAF-3, TAF 3, TAF-3 Blocking Peptide, TAF 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK |
|---|---|
| Molecular Weight | 103 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 is required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product