TAF7L antibody (70R-2547)

Rabbit polyclonal TAF7L antibody

Synonyms Polyclonal TAF7L antibody, Anti-TAF7L antibody, dJ738A13.1 antibody, Tbp-Associated Factor 50Kda antibody, TAF7L, FLJ23157 antibody, Taf7-Like Rna Polymerase Ii Tata Box Binding Protein antibody, TAFL-7 antibody, TAFL-7, TAFL 7, TAFL 7 antibody, TAF2Q antibody
Cross Reactivity Human
Applications WB
Immunogen TAF7L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ
Assay Information TAF7L Blocking Peptide, catalog no. 33R-7610, is also available for use as a blocking control in assays to test for specificity of this TAF7L antibody


Western Blot analysis using TAF7L antibody (70R-2547)

TAF7L antibody (70R-2547) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TAF7L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TAF7L antibody (70R-2547) | TAF7L antibody (70R-2547) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors