TAGAP Blocking Peptide (33R-10382)

A synthetic peptide for use as a blocking control in assays to test for specificity of TAGAP antibody, catalog no. 70R-10417

Synonyms TAGAP control peptide, TAGAP antibody Blocking Peptide, Anti-TAGAP Blocking Peptide, T-cell activation RhoGTPase activating protein Blocking Peptide, FKSG15 Blocking Peptide, FLJ32631 Blocking Peptide, FLJ39771 Blocking Peptide, IDDM21 Blocking Peptide, MGC133247 Blocking Peptide, MGC27381 Blocking Peptide, TAGAP1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLS
Molecular Weight 81 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that may function as a Rho GTPase-activating protein. Transcript variants encoding distinct isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors