TAL2 Blocking Peptide (33R-9261)
A synthetic peptide for use as a blocking control in assays to test for specificity of TAL2 antibody, catalog no. 70R-8270
Overview
Overview
| Synonyms | TAL2 control peptide, TAL2 antibody Blocking Peptide, Anti-TAL2 Blocking Peptide, T-cell acute lymphocytic leukemia 2 Blocking Peptide, TAL2, TAL-2, TAL 2, TAL-2 Blocking Peptide, TAL 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYI |
|---|---|
| Molecular Weight | 12 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product