TAL2 Blocking Peptide (33R-9261)

A synthetic peptide for use as a blocking control in assays to test for specificity of TAL2 antibody, catalog no. 70R-8270

Synonyms TAL2 control peptide, TAL2 antibody Blocking Peptide, Anti-TAL2 Blocking Peptide, T-cell acute lymphocytic leukemia 2 Blocking Peptide, TAL2, TAL-2, TAL 2, TAL-2 Blocking Peptide, TAL 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYI
Molecular Weight 12 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors