TASP1 antibody (70R-4354)

Rabbit polyclonal TASP1 antibody raised against the middle region of TASP1

Synonyms Polyclonal TASP1 antibody, Anti-TASP1 antibody, C20orf13 antibody, TASP-1 antibody, MGC39159 antibody, FLJ20212 antibody, dJ585I14.2 antibody, Taspase Threonine Aspartase 1 antibody, TASP 1, TASP1, TASP-1, TASP 1 antibody
Specificity TASP1 antibody was raised against the middle region of TASP1
Cross Reactivity Human
Applications WB
Immunogen TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI
Assay Information TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Images

Western Blot analysis using TASP1 antibody (70R-4354)

TASP1 antibody (70R-4354) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TASP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TASP1 antibody (70R-4354) | TASP1 antibody (70R-4354) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors