Tat Blocking Peptide (33R-10377)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tat antibody, catalog no. 70R-8790

Synonyms Tat control peptide, Tat antibody Blocking Peptide, Anti-Tat Blocking Peptide, tyrosine aminotransferase Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tat catalyzes the conversion of L-tyrosine and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-glutamate; It is involved in gluconeogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors