TBC1D1 antibody (70R-2415)

Rabbit polyclonal TBC1D1 antibody

Synonyms Polyclonal TBC1D1 antibody, Anti-TBC1D1 antibody, Tre-2/Usp6 Bub2 Cdc16 Domain Family 1 antibody, TBC-1 antibody, Tbc1 antibody, TBC 1, TBC-1, TBC-1 antibody, TBC 1 antibody, TBC antibody, TBC1, KIAA1108 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen TBC1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW
Assay Information TBC1D1 Blocking Peptide, catalog no. 33R-7942, is also available for use as a blocking control in assays to test for specificity of this TBC1D1 antibody

Images

Western blot analysis using TBC1D1 antibody (70R-2415)

Recommended TBC1D1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 133 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using TBC1D1 antibody (70R-2415) | Recommended TBC1D1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using TBC1D1 antibody (70R-2415) | Kidney

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors