TCL1A antibody (70R-2449)

Rabbit polyclonal TCL1A antibody raised against the N terminal of TCL1A

Synonyms Polyclonal TCL1A antibody, Anti-TCL1A antibody, T-Cell Leukemia/Lymphoma 1A antibody, TCLA-1 antibody, TCLA-1, TCLA 1 antibody, TCL1A, TCLA 1, TCL1 antibody
Specificity TCL1A antibody was raised against the N terminal of TCL1A
Cross Reactivity Human
Applications WB
Immunogen TCL1A antibody was raised using the N terminal of TCL1A corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
Assay Information TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody

Images

Western Blot analysis using TCL1A antibody (70R-2449)

TCL1A antibody (70R-2449) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TCL1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TCL1A antibody (70R-2449) | TCL1A antibody (70R-2449) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors