TDO2 antibody (70R-2686)

Rabbit polyclonal TDO2 antibody raised against the N terminal of TDO2

Synonyms Polyclonal TDO2 antibody, Anti-TDO2 antibody, Tryptophan 23-Dioxygenase antibody, TRPO antibody, TPH2 antibody, TDO2, TDO-2 antibody, TDO 2, TDO-2, TDO 2 antibody, TDO antibody
Specificity TDO2 antibody was raised against the N terminal of TDO2
Cross Reactivity Human
Applications WB
Immunogen TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
Assay Information TDO2 Blocking Peptide, catalog no. 33R-4940, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody


Western Blot analysis using TDO2 antibody (70R-2686)

TDO2 antibody (70R-2686) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TDO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tryptophan 2,3-dioxygenase (EC plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TDO2 antibody (70R-2686) | TDO2 antibody (70R-2686) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors