Tead4 Blocking Peptide (33R-10394)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tead4 antibody, catalog no. 70R-7987

Synonyms Tead4 control peptide, Tead4 antibody Blocking Peptide, Anti-Tead4 Blocking Peptide, TEA domain family member 4 Blocking Peptide, ETFR-2 Blocking Peptide, Etfr2 Blocking Peptide, FR-19 Blocking Peptide, TEAD-4 Blocking Peptide, TEF-3 Blocking Peptide, Tcf13r1 Blocking Peptide, Tef3 Blocking Peptide, Tefr Blocking Peptide, Tefr1 Blocking Peptide, Tefr1a Blocking Peptide, Tead4, Tead-4, Tead 4, Tead-4 Blocking Peptide, Tead 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY
Molecular Weight 48 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. This factor may play a role in the embryonic development of skeletal muscle. Alternatively spliced transcripts encoding distinct isoforms, which are translated through the use of a non-AUG (AUU) initiation codon, have been described for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors