TEX14 antibody (70R-2688)

Rabbit polyclonal TEX14 antibody raised against the C terminal of TEX14

Synonyms Polyclonal TEX14 antibody, Anti-TEX14 antibody, TEX 14, TEX-14, TEX 14 antibody, Testis Expressed 14 antibody, TEX-14 antibody, TEX14
Specificity TEX14 antibody was raised against the C terminal of TEX14
Cross Reactivity Human
Applications WB
Immunogen TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN
Assay Information TEX14 Blocking Peptide, catalog no. 33R-1529, is also available for use as a blocking control in assays to test for specificity of this TEX14 antibody


Western Blot analysis using TEX14 antibody (70R-2688)

TEX14 antibody (70R-2688) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 160 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEX14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TEX14 antibody (70R-2688) | TEX14 antibody (70R-2688) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors