TEX264 Blocking Peptide (33R-8543)

A synthetic peptide for use as a blocking control in assays to test for specificity of TEX264 antibody, catalog no. 70R-7352

Synonyms TEX264 control peptide, TEX264 antibody Blocking Peptide, Anti-TEX264 Blocking Peptide, Testis Expressed 264 Blocking Peptide, DKFZp451H0417 Blocking Peptide, FLJ13935 Blocking Peptide, SIG11 Blocking Peptide, ZSIG11 Blocking Peptide, TEX264, TEX-264, TEX 264, TEX-264 Blocking Peptide, TEX 264 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of TEX264 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors