TEX264 Blocking Peptide (33R-8543)
A synthetic peptide for use as a blocking control in assays to test for specificity of TEX264 antibody, catalog no. 70R-7352
Overview
Overview
| Synonyms | TEX264 control peptide, TEX264 antibody Blocking Peptide, Anti-TEX264 Blocking Peptide, Testis Expressed 264 Blocking Peptide, DKFZp451H0417 Blocking Peptide, FLJ13935 Blocking Peptide, SIG11 Blocking Peptide, ZSIG11 Blocking Peptide, TEX264, TEX-264, TEX 264, TEX-264 Blocking Peptide, TEX 264 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of TEX264 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product