Tgfb3 Blocking Peptide (33R-10344)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tgfb3 antibody, catalog no. 70R-8628

Synonyms Tgfb3 control peptide, Tgfb3 antibody Blocking Peptide, Anti-Tgfb3 Blocking Peptide, transforming growth factor, beta 3 Blocking Peptide, MGC105479 Blocking Peptide, Tgfb3, Tgfb-3, Tgfb 3, Tgfb-3 Blocking Peptide, Tgfb 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLE
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tgfb3 is involved in epithelial and endothelial cell proliferation and differentiation during development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors