TGFBI Blocking Peptide (33R-5094)
A synthetic peptide for use as a blocking control in assays to test for specificity of TGFBI antibody, catalog no. 70R-1826
Overview
Overview
| Synonyms | TGFBI control peptide, TGFBI antibody Blocking Peptide, Anti-TGFBI Blocking Peptide, TGFBI Blocking Peptide, Transforming Growth Factor Beta-Induced 68Kda Blocking Peptide, BIGH3 Blocking Peptide, CDB1 Blocking Peptide, CDG2 Blocking Peptide, CDGG1 Blocking Peptide, CSD Blocking Peptide, CSD1 Blocking Peptide, CSD2 Blocking Peptide, CSD3 Blocking Peptide, EBMD Blocking Peptide, LCD1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product