Thap11 Blocking Peptide (33R-1016)
A synthetic peptide for use as a blocking control in assays to test for specificity of Thap11 antibody, catalog no. 70R-9605
Overview
Overview
| Synonyms | Thap11 control peptide, Thap11 antibody Blocking Peptide, Anti-Thap11 Blocking Peptide, THAP domain containing 11 Blocking Peptide, 2810036E22Rik Blocking Peptide, AB041579 Blocking Peptide, CTG-B43a Blocking Peptide, CTG-B45d Blocking Peptide, Ronin Blocking Peptide, Thap11, Thap-11, Thap 11, Thap-11 Blocking Peptide, Thap 11 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product