Thap11 Blocking Peptide (33R-1016)

A synthetic peptide for use as a blocking control in assays to test for specificity of Thap11 antibody, catalog no. 70R-9605

Synonyms Thap11 control peptide, Thap11 antibody Blocking Peptide, Anti-Thap11 Blocking Peptide, THAP domain containing 11 Blocking Peptide, 2810036E22Rik Blocking Peptide, AB041579 Blocking Peptide, CTG-B43a Blocking Peptide, CTG-B45d Blocking Peptide, Ronin Blocking Peptide, Thap11, Thap-11, Thap 11, Thap-11 Blocking Peptide, Thap 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors