THAP5 Blocking Peptide (33R-9320)
A synthetic peptide for use as a blocking control in assays to test for specificity of THAP5 antibody, catalog no. 70R-4201
Overview
Overview
| Synonyms | THAP5 control peptide, THAP5 antibody Blocking Peptide, Anti-THAP5 Blocking Peptide, Thap Domain Containing 5 Blocking Peptide, THAP5, THAP-5, THAP 5, THAP-5 Blocking Peptide, THAP 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product