THG1L antibody (70R-3535)

Rabbit polyclonal THG1L antibody

Synonyms Polyclonal THG1L antibody, Anti-THG1L antibody, THG1L, THGL 1 antibody, ICF45 antibody, tRNA-Histidine Guanylyltransferase 1-Like antibody, THGL-1, THGL 1, FLJ20546 antibody, THGL-1 antibody, FLJ11601 antibody
Cross Reactivity Human
Applications WB
Immunogen THG1L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY
Assay Information THG1L Blocking Peptide, catalog no. 33R-1871, is also available for use as a blocking control in assays to test for specificity of this THG1L antibody


Western Blot analysis using THG1L antibody (70R-3535)

THG1L antibody (70R-3535) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THG1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using THG1L antibody (70R-3535) | THG1L antibody (70R-3535) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors