Thioredoxin 2 antibody (70R-2432)

Rabbit polyclonal Thioredoxin 2 antibody raised against the middle region of TXN2

Synonyms Polyclonal Thioredoxin 2 antibody, Anti-Thioredoxin 2 antibody, TXN2 antibody, MTRX antibody, TRX2 antibody, MT-TRX antibody
Specificity Thioredoxin 2 antibody was raised against the middle region of TXN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ
Assay Information Thioredoxin 2 Blocking Peptide, catalog no. 33R-7579, is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody


Western Blot analysis using Thioredoxin 2 antibody (70R-2432)

Thioredoxin 2 antibody (70R-2432) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Thioredoxin 2 antibody (70R-2432) | Thioredoxin 2 antibody (70R-2432) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors