THOC6 antibody (70R-3272)

Rabbit polyclonal THOC6 antibody

Synonyms Polyclonal THOC6 antibody, Anti-THOC6 antibody, THOC6, THOC-6 antibody, WDR58 antibody, THOC 6 antibody, THOC-6, Tho Complex 6 Homolog antibody, THOC 6, MGC2655 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
Assay Information THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Images

Western Blot analysis using THOC6 antibody (70R-3272)

THOC6 antibody (70R-3272) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THOC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using THOC6 antibody (70R-3272) | THOC6 antibody (70R-3272) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors