Thra Blocking Peptide (33R-6519)
A synthetic peptide for use as a blocking control in assays to test for specificity of Thra antibody, catalog no. 70R-8055
Overview
Overview
| Synonyms | Thra control peptide, Thra antibody Blocking Peptide, Anti-Thra Blocking Peptide, thyroid hormone receptor alpha Blocking Peptide, ERBA1 Blocking Peptide, Thra1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL |
|---|---|
| Molecular Weight | 55 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product