Thrombopoietin Blocking Peptide (33R-6770)
A synthetic peptide for use as a blocking control in assays to test for specificity of THPO antibody, catalog no. 70R-6200
Overview
Overview
| Synonyms | Thrombopoietin control peptide, Thrombopoietin antibody Blocking Peptide, Anti-Thrombopoietin Blocking Peptide, MGC163194 Blocking Peptide, MGDF Blocking Peptide, MKCSF Blocking Peptide, ML Blocking Peptide, MPLLG Blocking Peptide, TPO Blocking Peptide, Myeloproliferative Leukemia Virus Oncogene Ligand Megakaryocyte Growth And Development Factor Blocking Peptide, THPO Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product