Thrombopoietin Blocking Peptide (33R-6770)

A synthetic peptide for use as a blocking control in assays to test for specificity of THPO antibody, catalog no. 70R-6200

Synonyms Thrombopoietin control peptide, Thrombopoietin antibody Blocking Peptide, Anti-Thrombopoietin Blocking Peptide, MGC163194 Blocking Peptide, MGDF Blocking Peptide, MKCSF Blocking Peptide, ML Blocking Peptide, MPLLG Blocking Peptide, TPO Blocking Peptide, Myeloproliferative Leukemia Virus Oncogene Ligand Megakaryocyte Growth And Development Factor Blocking Peptide, THPO Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors