THYN1 Blocking Peptide (33R-6820)
A synthetic peptide for use as a blocking control in assays to test for specificity of THYN1 antibody, catalog no. 70R-3715
Overview
Overview
| Synonyms | THYN1 control peptide, THYN1 antibody Blocking Peptide, Anti-THYN1 Blocking Peptide, Thymocyte Nuclear Protein 1 Blocking Peptide, HSPC144 Blocking Peptide, MDS012 Blocking Peptide, MGC12187 Blocking Peptide, MY105 Blocking Peptide, THY28 Blocking Peptide, THY28KD Blocking Peptide, THYN1, THYN-1, THYN 1, THYN-1 Blocking Peptide, THYN 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product