THYN1 Blocking Peptide (33R-6820)

A synthetic peptide for use as a blocking control in assays to test for specificity of THYN1 antibody, catalog no. 70R-3715

Synonyms THYN1 control peptide, THYN1 antibody Blocking Peptide, Anti-THYN1 Blocking Peptide, Thymocyte Nuclear Protein 1 Blocking Peptide, HSPC144 Blocking Peptide, MDS012 Blocking Peptide, MGC12187 Blocking Peptide, MY105 Blocking Peptide, THY28 Blocking Peptide, THY28KD Blocking Peptide, THYN1, THYN-1, THYN 1, THYN-1 Blocking Peptide, THYN 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors