TIGD4 Blocking Peptide (33R-7898)

A synthetic peptide for use as a blocking control in assays to test for specificity of TIGD4 antibody, catalog no. 70R-2988

Synonyms TIGD4 control peptide, TIGD4 antibody Blocking Peptide, Anti-TIGD4 Blocking Peptide, Tigger Transposable Element Derived 4 Blocking Peptide, MGC43837 Blocking Peptide, TIGD4, TIGD-4, TIGD 4, TIGD-4 Blocking Peptide, TIGD 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK
Molecular Weight 57 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors