TINAGL1 Blocking Peptide (33R-6759)

A synthetic peptide for use as a blocking control in assays to test for specificity of TINAGL1 antibody, catalog no. 70R-4039

Synonyms TINAGL1 control peptide, TINAGL1 antibody Blocking Peptide, Anti-TINAGL1 Blocking Peptide, ARG1 Blocking Peptide, LCN7 Blocking Peptide, LIECG3 Blocking Peptide, TINAGRP Blocking Peptide, Tubulointerstitial Nephritis Antigen-Like 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors