TINAGL1 Blocking Peptide (33R-6759)
A synthetic peptide for use as a blocking control in assays to test for specificity of TINAGL1 antibody, catalog no. 70R-4039
Overview
Overview
| Synonyms | TINAGL1 control peptide, TINAGL1 antibody Blocking Peptide, Anti-TINAGL1 Blocking Peptide, ARG1 Blocking Peptide, LCN7 Blocking Peptide, LIECG3 Blocking Peptide, TINAGRP Blocking Peptide, Tubulointerstitial Nephritis Antigen-Like 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product