TKTL1 antibody (70R-2668)

Rabbit polyclonal TKTL1 antibody raised against the middle region of TKTL1

Synonyms Polyclonal TKTL1 antibody, Anti-TKTL1 antibody, TKTL 1 antibody, TKTL-1 antibody, TKTL 1, TKT2 antibody, TKR antibody, Transketolase-Like 1 antibody, TKTL-1, TKTL1
Specificity TKTL1 antibody was raised against the middle region of TKTL1
Cross Reactivity Human
Applications WB
Immunogen TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
Assay Information TKTL1 Blocking Peptide, catalog no. 33R-7593, is also available for use as a blocking control in assays to test for specificity of this TKTL1 antibody


Western Blot analysis using TKTL1 antibody (70R-2668)

TKTL1 antibody (70R-2668) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TKTL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TKTL1 antibody (70R-2668) | TKTL1 antibody (70R-2668) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors