TKTL2 antibody (70R-1207)

Rabbit polyclonal TKTL2 antibody raised against the C terminal of TKTL2

Synonyms Polyclonal TKTL2 antibody, Anti-TKTL2 antibody, FLJ32975 antibody, Transketolase-Like 2 antibody, TKTL 2, DKFZP434L1717 antibody, TKTL2, TKTL-2 antibody, TKTL 2 antibody, TKTL-2
Specificity TKTL2 antibody was raised against the C terminal of TKTL2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
Assay Information TKTL2 Blocking Peptide, catalog no. 33R-8786, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody


Western Blot analysis using TKTL2 antibody (70R-1207)

TKTL2 antibody (70R-1207) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TKTL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TKTL2 plays an essential role in total transketolase activity and cell proliferation in cancer cells. After transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. TKTL2 may also play a pivotal role in carcinogenesis

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TKTL2 antibody (70R-1207) | TKTL2 antibody (70R-1207) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors