TLR8 antibody (70R-14932)

Affinity purified goat polyclonal TLR8 antibody

Synonyms Polyclonal TLR8 antibody, Anti-TLR8 antibody, Toll like receptor 8 antibody, TLR8, TLR 8, TLR-8, TLR 8 antibody, TLR-8 antibody, Toll-like receptor 8 antibody
Applications IHC, WB
Immunogen TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen

Images

Immunohistochemical staining using TLR8 antibody (70R-14932)

Immunohistochemical staining showingTLR8 on mouse spleen

Specifications

Host Goat
Method of Purification TLR8 antibody was purified by affinity chromatography
Form & Buffer Supplied in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations IHC: 1:125, WB: 1:500

Storage & Safety

Storage Aliquot and freeze at -20 degC. Avoid freeze-thaw cycles

General Information

Biological Significance The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TLR8 antibody (70R-14932) | Immunohistochemical staining showingTLR8 on mouse spleen
  • Immunohistochemical staining using TLR8 antibody (70R-14932) | Immunohistochemical staining showing TLR8 on human tonsil

Availability: In stock

Size: 200 ug
Shipping
View Our Distributors