TMEM126B Blocking Peptide (33R-1047)
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM126B antibody, catalog no. 70R-6675
Overview
Overview
| Synonyms | TMEM126B control peptide, TMEM126B antibody Blocking Peptide, Anti-TMEM126B Blocking Peptide, Transmembrane Protein 126B Blocking Peptide, HT007 Blocking Peptide, MGC111203 Blocking Peptide, TMEM126B, TMEMB-126, TMEMB 126, TMEMB-126 Blocking Peptide, TMEMB 126 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TMEM126B belongs to the TMEM126 family. The function remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product