TMEM126B Blocking Peptide (33R-1047)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM126B antibody, catalog no. 70R-6675

Synonyms TMEM126B control peptide, TMEM126B antibody Blocking Peptide, Anti-TMEM126B Blocking Peptide, Transmembrane Protein 126B Blocking Peptide, HT007 Blocking Peptide, MGC111203 Blocking Peptide, TMEM126B, TMEMB-126, TMEMB 126, TMEMB-126 Blocking Peptide, TMEMB 126 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM126B belongs to the TMEM126 family. The function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors