Tmem132d Blocking Peptide (33R-10385)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem132d antibody, catalog no. 70R-8866

Synonyms Tmem132d control peptide, Tmem132d antibody Blocking Peptide, Anti-Tmem132d Blocking Peptide, transmembrane protein 132D Blocking Peptide, C630028F04Rik Blocking Peptide, Tmem132d, Tmemd-132, Tmemd 132, Tmemd-132 Blocking Peptide, Tmemd 132 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK
Molecular Weight 121 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tmem132d may serve as a cell-surface marker for oligodendrocyte differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors