TMEM163 Blocking Peptide (33R-1058)
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM163 antibody, catalog no. 70R-6376
Overview
Overview
| Synonyms | TMEM163 control peptide, TMEM163 antibody Blocking Peptide, Anti-TMEM163 Blocking Peptide, Transmembrane Protein 163 Blocking Peptide, DC29 Blocking Peptide, DKFZP566N034 Blocking Peptide, DKFZp666J217 Blocking Peptide, SV31 Blocking Peptide, TMEM163, TMEM-163, TMEM 163, TMEM-163 Blocking Peptide, TMEM 163 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product