TMEM163 Blocking Peptide (33R-1058)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM163 antibody, catalog no. 70R-6376

Synonyms TMEM163 control peptide, TMEM163 antibody Blocking Peptide, Anti-TMEM163 Blocking Peptide, Transmembrane Protein 163 Blocking Peptide, DC29 Blocking Peptide, DKFZP566N034 Blocking Peptide, DKFZp666J217 Blocking Peptide, SV31 Blocking Peptide, TMEM163, TMEM-163, TMEM 163, TMEM-163 Blocking Peptide, TMEM 163 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV
Molecular Weight 31 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors