RPL32 Blocking Peptide (33R-1035)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM166 antibody, catalog no. 70R-9643

Synonyms TMEM166 control peptide, TMEM166 antibody Blocking Peptide, Anti-TMEM166 Blocking Peptide, family with sequence similarity 176, member A Blocking Peptide, FLJ13391 Blocking Peptide, TMEM166 Blocking Peptide, TMEM166, TMEM-166, TMEM 166, TMEM-166 Blocking Peptide, TMEM 166 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH
Molecular Weight 17 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors