RPL32 Blocking Peptide (33R-1035)
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM166 antibody, catalog no. 70R-9643
Overview
Overview
| Synonyms | TMEM166 control peptide, TMEM166 antibody Blocking Peptide, Anti-TMEM166 Blocking Peptide, family with sequence similarity 176, member A Blocking Peptide, FLJ13391 Blocking Peptide, TMEM166 Blocking Peptide, TMEM166, TMEM-166, TMEM 166, TMEM-166 Blocking Peptide, TMEM 166 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH |
|---|---|
| Molecular Weight | 17 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product