TMEM173 antibody (70R-2359)

Rabbit polyclonal TMEM173 antibody raised against the middle region of TMEM173

Synonyms Polyclonal TMEM173 antibody, Anti-TMEM173 antibody, TMEM 173 antibody, FLJ38577 antibody, TMEM173, Transmembrane Protein 173 antibody, TMEM 173, TMEM-173 antibody, TMEM-173
Specificity TMEM173 antibody was raised against the middle region of TMEM173
Cross Reactivity Human
Applications WB
Immunogen TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL
Assay Information TMEM173 Blocking Peptide, catalog no. 33R-2109, is also available for use as a blocking control in assays to test for specificity of this TMEM173 antibody

Images

Western Blot analysis using TMEM173 antibody (70R-2359)

TMEM173 antibody (70R-2359) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM173 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM173 antibody (70R-2359) | TMEM173 antibody (70R-2359) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €352.82
Size: 50 ug
OR
Shipping
View Our Distributors