TMEM93 Blocking Peptide (33R-1062)
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM93 antibody, catalog no. 70R-6642
Overview
Overview
| Synonyms | TMEM93 control peptide, TMEM93 antibody Blocking Peptide, Anti-TMEM93 Blocking Peptide, Transmembrane Protein 93 Blocking Peptide, MGC2963 Blocking Peptide, TMEM93, TMEM-93, TMEM 93, TMEM-93 Blocking Peptide, TMEM 93 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
|---|---|
| Molecular Weight | 12 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product