TMEM93 Blocking Peptide (33R-1062)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM93 antibody, catalog no. 70R-6642

Synonyms TMEM93 control peptide, TMEM93 antibody Blocking Peptide, Anti-TMEM93 Blocking Peptide, Transmembrane Protein 93 Blocking Peptide, MGC2963 Blocking Peptide, TMEM93, TMEM-93, TMEM 93, TMEM-93 Blocking Peptide, TMEM 93 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Molecular Weight 12 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors