TMPRSS3 antibody (70R-3257)

Rabbit polyclonal TMPRSS3 antibody raised against the N terminal of TMPRSS3

Synonyms Polyclonal TMPRSS3 antibody, Anti-TMPRSS3 antibody, TMPRSS3, TMPRSS-3 antibody, Transmembrane Protease Serine 3 antibody, DFNB10 antibody, TADG12 antibody, DFNB8 antibody, TMPRSS-3, TMPRSS 3, ECHOS1 antibody, TMPRSS 3 antibody
Specificity TMPRSS3 antibody was raised against the N terminal of TMPRSS3
Cross Reactivity Human
Applications WB
Immunogen TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
Assay Information TMPRSS3 Blocking Peptide, catalog no. 33R-6022, is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody

Images

Western Blot analysis using TMPRSS3 antibody (70R-3257)

TMPRSS3 antibody (70R-3257) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMPRSS3 antibody (70R-3257) | TMPRSS3 antibody (70R-3257) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors