TMPRSS4 antibody (70R-4487)

Rabbit polyclonal TMPRSS4 antibody raised against the middle region of TMPRSS4

Synonyms Polyclonal TMPRSS4 antibody, Anti-TMPRSS4 antibody, Transmembrane Protease Serine 4 antibody, TMPRSS 4, TMPRSS 4 antibody, TMPRSS-4, TMPRSS3 antibody, MT-SP2 antibody, TMPRSS4, TMPRSS-4 antibody
Specificity TMPRSS4 antibody was raised against the middle region of TMPRSS4
Cross Reactivity Human
Applications WB
Immunogen TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
Assay Information TMPRSS4 Blocking Peptide, catalog no. 33R-5428, is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody


Western Blot analysis using TMPRSS4 antibody (70R-4487)

TMPRSS4 antibody (70R-4487) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMPRSS4 antibody (70R-4487) | TMPRSS4 antibody (70R-4487) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors