TMTC4 antibody (70R-6734)

Rabbit polyclonal TMTC4 antibody raised against the C terminal of TMTC4

Synonyms Polyclonal TMTC4 antibody, Anti-TMTC4 antibody, TMTC-4 antibody, TMTC4, FLJ14624 antibody, Transmembrane And Tetratricopeptide Repeat Containing 4 antibody, TMTC 4 antibody, TMTC 4, FLJ22153 antibody, TMTC-4
Specificity TMTC4 antibody was raised against the C terminal of TMTC4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW
Assay Information TMTC4 Blocking Peptide, catalog no. 33R-6658, is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody


Western Blot analysis using TMTC4 antibody (70R-6734)

TMTC4 antibody (70R-6734) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMTC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMTC4 antibody (70R-6734) | TMTC4 antibody (70R-6734) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors