TNF protein (Bovine) (His tag) (80R-3429)

Purified recombinant TNF protein (Bovine) (His tag)

Synonyms Cachectin protein, TNF alpha protein, Tumor necrosis factor ligand superfamily member 2 protein, TNF a protein, Tumor necrosis factor protein
Species Bovine
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using TNF protein (Bovine) (His tag) (80R-3429)

Specifications

Residues LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD YLDYAESGQVYFGIIAL
Expression System E.coli
Source His-fusion expressed in cell supernatent (soluble under denaturing conditions)
Grade & Purity > 95% pure
Molecular Weight 23 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in PBS buffer

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance TNF is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using TNF protein (Bovine) (His tag) (80R-3429)

Availability: In stock

Price: €182.41
Size: 50 ug
OR
Shipping
View Our Distributors