TNF protein (Bovine) (His tag) (80R-3430)
Purified recombinant TNF protein (Bovine) (His tag)
Overview
Overview
| Synonyms | Cachectin protein, TNF alpha protein, Tumor necrosis factor ligand superfamily member 2 protein, TNF a protein, Tumor necrosis factor protein |
|---|---|
| Species | Bovine |
| Protein Type | Recombinant |
| Applications | ELISA, SDS-PAGE, WB |
Specifications
| Residues | LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD YLDYAESGQVYFGIIAL |
|---|---|
| Expression System | E.coli |
| Source | His-fusion expressed as an inclusion body |
| Grade & Purity | > 95% pure |
| Molecular Weight | 23 kDa |
| Tag/Conjugate | His tag |
| Form & Buffer | Supplied in liquid form in 20mM Tris-Hcl, 0.5MNaCl, 10% glycerin (pH 8.0) and 200 mM Imidazole |
Storage & Safety
| Storage | Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles |
|---|
General Information
| Biological Significance | TNF is a potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product