TNFRSF21 Blocking Peptide (33R-9334)
A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF21 antibody, catalog no. 70R-7549
Overview
Overview
| Synonyms | TNFRSF21 control peptide, TNFRSF21 antibody Blocking Peptide, Anti-TNFRSF21 Blocking Peptide, Tumor Necrosis Factor Receptor Superfamily Member 21 Blocking Peptide, BM-018 Blocking Peptide, DR6 Blocking Peptide, MGC31965 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
|---|---|
| Molecular Weight | 68 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product