TNFRSF21 Blocking Peptide (33R-9334)

A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF21 antibody, catalog no. 70R-7549

Synonyms TNFRSF21 control peptide, TNFRSF21 antibody Blocking Peptide, Anti-TNFRSF21 Blocking Peptide, Tumor Necrosis Factor Receptor Superfamily Member 21 Blocking Peptide, BM-018 Blocking Peptide, DR6 Blocking Peptide, MGC31965 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV
Molecular Weight 68 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors