TNKS1BP1 antibody (70R-2291)

Rabbit polyclonal TNKS1BP1 antibody raised against the middle region of TNKS1BP1

Synonyms Polyclonal TNKS1BP1 antibody, Anti-TNKS1BP1 antibody, TAB182 antibody, KIAA1741 antibody, FLJ45975 antibody, Tankyrase 1 Binding Protein 1 182Kda antibody
Specificity TNKS1BP1 antibody was raised against the middle region of TNKS1BP1
Cross Reactivity Human
Applications WB
Immunogen TNKS1BP1 antibody was raised using the middle region of TNKS1BP1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE
Assay Information TNKS1BP1 Blocking Peptide, catalog no. 33R-1945, is also available for use as a blocking control in assays to test for specificity of this TNKS1BP1 antibody


Western Blot analysis using TNKS1BP1 antibody (70R-2291)

TNKS1BP1 antibody (70R-2291) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 190 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNKS1BP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TNKS1BP1 antibody (70R-2291) | TNKS1BP1 antibody (70R-2291) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors