TOM1 antibody (70R-4061)

Rabbit polyclonal TOM1 antibody

Synonyms Polyclonal TOM1 antibody, Anti-TOM1 antibody, FLJ33404 antibody, TOM1, TOM-1 antibody, Target Of Myb1 antibody, TOM 1, TOM 1 antibody, TOM-1
Cross Reactivity Human
Applications WB
Immunogen TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA
Assay Information TOM1 Blocking Peptide, catalog no. 33R-8487, is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody

Images

Western Blot analysis using TOM1 antibody (70R-4061)

TOM1 antibody (70R-4061) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TOM1 antibody (70R-4061) | TOM1 antibody (70R-4061) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors