TOMM40L antibody (70R-5055)

Rabbit polyclonal TOMM40L antibody

Synonyms Polyclonal TOMM40L antibody, Anti-TOMM40L antibody, TOMML 40 antibody, RP11-297K8.10 antibody, FLJ12770 antibody, TOMM40L, Translocase Of Outer Mitochondrial Membrane 40 Homolog antibody, TOMML 40, TOMML-40 antibody, TOMML-40, TOMM40B antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TOMM40L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD
Assay Information TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody


Western Blot analysis using TOMM40L antibody (70R-5055)

TOMM40L antibody (70R-5055) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOMM40L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TOMM40L antibody (70R-5055) | TOMM40L antibody (70R-5055) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors