TOR2A antibody (70R-1821)

Rabbit polyclonal TOR2A antibody raised against the N terminal of TOR2A

Synonyms Polyclonal TOR2A antibody, Anti-TOR2A antibody, TORA 2, Torsin Family 2 Member A antibody, FLJ14771 antibody, TORA-2, TORA 2 antibody, TORP1 antibody, TORA-2 antibody, MGC99558 antibody, TOR2A
Specificity TOR2A antibody was raised against the N terminal of TOR2A
Cross Reactivity Human,Mouse
Applications WB
Immunogen TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS
Assay Information TOR2A Blocking Peptide, catalog no. 33R-3388, is also available for use as a blocking control in assays to test for specificity of this TOR2A antibody


Western Blot analysis using TOR2A antibody (70R-1821)

TOR2A antibody (70R-1821) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TOR2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TOR2A protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TOR2A antibody (70R-1821) | TOR2A antibody (70R-1821) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors