TOR3A antibody (70R-5464)

Rabbit polyclonal TOR3A antibody raised against the middle region of TOR3A

Synonyms Polyclonal TOR3A antibody, Anti-TOR3A antibody, MGC111104 antibody, TORA-3, Torsin Family 3 Member A antibody, TORA 3, TOR3A, FLJ22345 antibody, ADIR2 antibody, TORA 3 antibody, TORA-3 antibody, ADIR antibody
Specificity TOR3A antibody was raised against the middle region of TOR3A
Cross Reactivity Human,Dog
Applications WB
Immunogen TOR3A antibody was raised using the middle region of TOR3A corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP
Assay Information TOR3A Blocking Peptide, catalog no. 33R-2919, is also available for use as a blocking control in assays to test for specificity of this TOR3A antibody

Images

Western Blot analysis using TOR3A antibody (70R-5464)

TOR3A antibody (70R-5464) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOR3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TOR3A protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TOR3A antibody (70R-5464) | TOR3A antibody (70R-5464) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors