TPH2 antibody (70R-2005)

Rabbit polyclonal TPH2 antibody raised against the middle region of TPH2

Synonyms Polyclonal TPH2 antibody, Anti-TPH2 antibody, MGC138872 antibody, NTPH antibody, TPH-2, FLJ37295 antibody, TPH2, Tryptophan Hydroxylase 2 antibody, TPH 2, MGC138871 antibody, TPH-2 antibody, TPH 2 antibody
Specificity TPH2 antibody was raised against the middle region of TPH2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
Assay Information TPH2 Blocking Peptide, catalog no. 33R-4561, is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody

Images

Western Blot analysis using TPH2 antibody (70R-2005)

TPH2 antibody (70R-2005) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tryptophan hydroxylase (TPH; EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TPH2 antibody (70R-2005) | TPH2 antibody (70R-2005) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors