TPI1 antibody (70R-2004)

Rabbit polyclonal TPI1 antibody raised against the N terminal of TPI1

Synonyms Polyclonal TPI1 antibody, Anti-TPI1 antibody, TPI antibody, TPI1, TPI-1, Triosephosphate Isomerase 1 antibody, MGC88108 antibody, TPI 1 antibody, TPI-1 antibody, TPI 1
Specificity TPI1 antibody was raised against the N terminal of TPI1
Cross Reactivity Human
Applications WB
Immunogen TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
Assay Information TPI1 Blocking Peptide, catalog no. 33R-5717, is also available for use as a blocking control in assays to test for specificity of this TPI1 antibody

Images

Western Blot analysis using TPI1 antibody (70R-2004)

TPI1 antibody (70R-2004) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPI1 belongs to the triosephosphate isomerase family. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) . TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TPI1 antibody (70R-2004) | TPI1 antibody (70R-2004) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors