TRA16 antibody (70R-4197)

Rabbit polyclonal TRA16 antibody raised against the N terminal Of Tra16

Synonyms Polyclonal TRA16 antibody, Anti-TRA16 antibody, TRA 16, Nuclear receptor 2C2 associated protein antibody, TR4 orphan receptor associated 16 kDa protein antibody, NR2C2AP antibody, TRA16, TRA 16 antibody, TRA-16, Repressor for TR4 transactivation antibody, TRA-16 antibody, TR4 orphan receptor associated protein TRA16 antibody
Specificity TRA16 antibody was raised against the N terminal Of Tra16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRA16 antibody was raised using the N terminal Of Tra16 corresponding to a region with amino acids THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL
Assay Information TRA16 Blocking Peptide, catalog no. 33R-9109, is also available for use as a blocking control in assays to test for specificity of this TRA16 antibody


Western Blot analysis using TRA16 antibody (70R-4197)

TRA16 antibody (70R-4197) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRA16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRA16 may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRA16 antibody (70R-4197) | TRA16 antibody (70R-4197) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors